For Research Use Only — Not for Human Consumption

International Shipping Available — Dispatched Worldwide from the UK

  • Free UK shippingTracked, orders over £50
  • Same-day dispatchOrder before 3pm GMT
  • CoA on every batchHPLC purity report
Back to catalogue

Cathelicidin peptide

LL-37 — Research Peptide

LL-37 is the only human cathelicidin, used in antimicrobial and wound-healing research models.

Independently Accredited Third-Party Lab Tested · Batch CoA

Every batch of LL-37 is verified by an independently accredited third-party laboratory (HPLC purity 99.0% + mass-spec identity) and dispatched from the UK with its batch-specific CoA available on request.

In stock · 5mg
1

Subtotal

£84.00

≈ $107 · €98
Free UK shipping over £50 (tracked). Typical delivery:UK 1–3 daysEU 3–7 daysUS 5–10 days
LL-37 research vial with Professor Peptide label
Product image · illustrative
CAS
154947-66-7
Purity (HPLC)
99.0%
Molecular Weight
4493.3 g/mol
Sequence
[LL-37, 37 aa]

Research Applications

LL-37 is supplied for the following categories of in-vitro laboratory research only. It is not supplied, intended or licensed for human or veterinary use.

  • In-vitro fibroblast and tenocyte proliferation assays
  • Angiogenesis and tube-formation studies in endothelial cell lines
  • Wound-closure scratch assays and migration modelling
  • Comparative cytoprotective and anti-inflammatory pathway research

Storage & Handling

Store unopened lyophilised vials at −20 °C, protected from light. Reconstitute with bacteriostatic water and store at 2–8 °C. Handle in a sterile environment with appropriate PPE.

Quality & Compliance

99.0% HPLC purity verified by an independently accredited third-party lab, MS identity confirmed. Every batch ships with a batch-specific Certificate of Analysis on request. UK-based supplier, UK tracked dispatch.

LL-37 — Frequently Asked Questions

Is LL-37 legal to buy in the UK?+

Yes. LL-37 is supplied as a research peptide for in-vitro laboratory use only and is not a controlled substance under the Misuse of Drugs Act 1971. It is legal to purchase, possess and store in the UK for research. It is not supplied for human use.

Is a Certificate of Analysis (CoA) provided for LL-37?+

Yes. Every batch of LL-37 is tested by an independently accredited third-party laboratory, and the batch-specific Certificate of Analysis — covering HPLC purity (99.0%) and mass-spectrometry identity confirmation — is available on request.

How is LL-37 shipped and stored?+

LL-37 is shipped lyophilised at ambient temperature from the UK. On arrival, store the unopened vial at −20 °C protected from light. Once reconstituted with bacteriostatic water, store at 2–8 °C and use within the stability window for the peptide class.

How long does delivery take?+

Orders confirmed before 2pm are dispatched same working day from the UK via tracked courier. Typical delivery: UK 1–3 days, EU 3–7 days, US 5–10 business days. Tracked shipping is free on every order.

What purity is LL-37 supplied at?+

LL-37 is supplied at 99.0% purity by HPLC, verified by an independently accredited third-party laboratory with identity confirmed by mass spectrometry. The molecular weight is 4493.3 g/mol.

Join the Professor's mailing list

UK-based supplier. CoA per batch. No spam — choose exactly what you want.

One-click unsubscribe in every email · UK GDPR compliant

Browse UK Collections

Related Healing & Repair Peptides

5mg · Qty 1

£84.00

≈ $107 · €98