Cathelicidin peptide
LL-37 — Research Peptide
LL-37 is the only human cathelicidin, used in antimicrobial and wound-healing research models.
- CAS
- 154947-66-7
- Purity (HPLC)
- 99.0%
- Molecular Weight
- 4493.3 g/mol
- Sequence
- [LL-37, 37 aa]
UK-Sourced · Batch Certificate of Analysis
Dispatched from the UK. A batch-specific CoA (HPLC purity 99.0% + mass-spec identity) is available on request for every lot of LL-37.
Subtotal
£84.00
Research Applications
LL-37 is supplied for the following categories of in-vitro laboratory research only. It is not supplied, intended or licensed for human or veterinary use.
- In-vitro fibroblast and tenocyte proliferation assays
- Angiogenesis and tube-formation studies in endothelial cell lines
- Wound-closure scratch assays and migration modelling
- Comparative cytoprotective and anti-inflammatory pathway research
Storage & Handling
Store unopened lyophilised vials at −20 °C, protected from light. Reconstitute with bacteriostatic water and store at 2–8 °C. Handle in a sterile environment with appropriate PPE.
Quality & Compliance
99.0% HPLC purity, MS identity confirmed. Every batch ships with a Certificate of Analysis on request. UK-based supplier, UK tracked dispatch.
LL-37 — Frequently Asked Questions
Is LL-37 legal to buy in the UK?+
Yes. LL-37 is supplied as a research peptide for in-vitro laboratory use only and is not a controlled substance under the Misuse of Drugs Act 1971. It is legal to purchase, possess and store in the UK for research. It is not supplied for human use.
Is a Certificate of Analysis (CoA) provided for LL-37?+
Yes. A batch-specific Certificate of Analysis covering HPLC purity (99.0%) and mass-spectrometry identity confirmation is available on request for every lot of LL-37 we dispatch.
How is LL-37 shipped and stored?+
LL-37 is shipped lyophilised at ambient temperature from the UK. On arrival, store the unopened vial at −20 °C protected from light. Once reconstituted with bacteriostatic water, store at 2–8 °C and use within the stability window for the peptide class.
How long does UK delivery take?+
Orders confirmed before 2pm are dispatched same working day via UK tracked courier. Standard delivery is 1–2 working days. Free UK tracked shipping on orders over £200.
What purity is LL-37 supplied at?+
LL-37 is supplied at 99.0% purity by HPLC, with identity confirmed by mass spectrometry. The molecular weight is 4493.3 g/mol.