28-aa neuropeptide
VIP (Vasoactive Intestinal Peptide) — Research Peptide
VIP is a 28-aa neuropeptide used in immunomodulation and vasodilation research.
Independently Accredited Third-Party Lab Tested · Batch CoA
Every batch of VIP (Vasoactive Intestinal Peptide) is verified by an independently accredited third-party laboratory (HPLC purity 99.0% + mass-spec identity) and dispatched from the UK with its batch-specific CoA available on request.
Subtotal
£94.00
≈ $119 · €110
- CAS
- 37221-79-7
- Purity (HPLC)
- 99.0%
- Molecular Weight
- 3326.8 g/mol
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Research Applications
VIP (Vasoactive Intestinal Peptide) is supplied for the following categories of in-vitro laboratory research only. It is not supplied, intended or licensed for human or veterinary use.
- Receptor binding and selectivity studies on neuronal cell lines
- Cognitive-pathway signalling and neurotrophic factor expression
- BBB-permeability modelling in in-vitro systems
- Comparative nootropic peptide pharmacology
Storage & Handling
Store unopened lyophilised vials at −20 °C, protected from light. Reconstitute with bacteriostatic water and store at 2–8 °C. Handle in a sterile environment with appropriate PPE.
Quality & Compliance
99.0% HPLC purity verified by an independently accredited third-party lab, MS identity confirmed. Every batch ships with a batch-specific Certificate of Analysis on request. UK-based supplier, UK tracked dispatch.
VIP (Vasoactive Intestinal Peptide) — Frequently Asked Questions
Is VIP (Vasoactive Intestinal Peptide) legal to buy in the UK?+
Yes. VIP (Vasoactive Intestinal Peptide) is supplied as a research peptide for in-vitro laboratory use only and is not a controlled substance under the Misuse of Drugs Act 1971. It is legal to purchase, possess and store in the UK for research. It is not supplied for human use.
Is a Certificate of Analysis (CoA) provided for VIP (Vasoactive Intestinal Peptide)?+
Yes. Every batch of VIP (Vasoactive Intestinal Peptide) is tested by an independently accredited third-party laboratory, and the batch-specific Certificate of Analysis — covering HPLC purity (99.0%) and mass-spectrometry identity confirmation — is available on request.
How is VIP (Vasoactive Intestinal Peptide) shipped and stored?+
VIP (Vasoactive Intestinal Peptide) is shipped lyophilised at ambient temperature from the UK. On arrival, store the unopened vial at −20 °C protected from light. Once reconstituted with bacteriostatic water, store at 2–8 °C and use within the stability window for the peptide class.
How long does delivery take?+
Orders confirmed before 2pm are dispatched same working day from the UK via tracked courier. Typical delivery: UK 1–3 days, EU 3–7 days, US 5–10 business days. Tracked shipping is free on every order.
What purity is VIP (Vasoactive Intestinal Peptide) supplied at?+
VIP (Vasoactive Intestinal Peptide) is supplied at 99.0% purity by HPLC, verified by an independently accredited third-party laboratory with identity confirmed by mass spectrometry. The molecular weight is 3326.8 g/mol.