For Research Use Only — Not for Human Consumption

UK-Based Supplier · Certificate of Analysis (CoA) Provided on Every Batch

For Research Use Only — Not for Human Consumption

UK-Based Supplier · Certificate of Analysis (CoA) Provided on Every Batch

Back to catalogue

p53-derived peptide

PNC-27 — Research Peptide

PNC-27 is a synthetic p53-derived peptide used in cell-membrane targeting research.

CAS
Purity (HPLC)
99.0%
Molecular Weight
3194.8 g/mol
Sequence
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

UK-Sourced · Batch Certificate of Analysis

Dispatched from the UK. A batch-specific CoA (HPLC purity 99.0% + mass-spec identity) is available on request for every lot of PNC-27.

1

Subtotal

£114.00

Research Applications

PNC-27 is supplied for the following categories of in-vitro laboratory research only. It is not supplied, intended or licensed for human or veterinary use.

  • In-vitro fibroblast and tenocyte proliferation assays
  • Angiogenesis and tube-formation studies in endothelial cell lines
  • Wound-closure scratch assays and migration modelling
  • Comparative cytoprotective and anti-inflammatory pathway research

Storage & Handling

Store unopened lyophilised vials at −20 °C, protected from light. Reconstitute with bacteriostatic water and store at 2–8 °C. Handle in a sterile environment with appropriate PPE.

Quality & Compliance

99.0% HPLC purity, MS identity confirmed. Every batch ships with a Certificate of Analysis on request. UK-based supplier, UK tracked dispatch.

PNC-27 — Frequently Asked Questions

Is PNC-27 legal to buy in the UK?+

Yes. PNC-27 is supplied as a research peptide for in-vitro laboratory use only and is not a controlled substance under the Misuse of Drugs Act 1971. It is legal to purchase, possess and store in the UK for research. It is not supplied for human use.

Is a Certificate of Analysis (CoA) provided for PNC-27?+

Yes. A batch-specific Certificate of Analysis covering HPLC purity (99.0%) and mass-spectrometry identity confirmation is available on request for every lot of PNC-27 we dispatch.

How is PNC-27 shipped and stored?+

PNC-27 is shipped lyophilised at ambient temperature from the UK. On arrival, store the unopened vial at −20 °C protected from light. Once reconstituted with bacteriostatic water, store at 2–8 °C and use within the stability window for the peptide class.

How long does UK delivery take?+

Orders confirmed before 2pm are dispatched same working day via UK tracked courier. Standard delivery is 1–2 working days. Free UK tracked shipping on orders over £200.

What purity is PNC-27 supplied at?+

PNC-27 is supplied at 99.0% purity by HPLC, with identity confirmed by mass spectrometry. The molecular weight is 3194.8 g/mol.

Related Healing & Repair Peptides